Research Use Only

99.2% Purity

Sourced inUSA
Ships fromOhio

Free shipping $250+Same-day by 2 PM ET

Research Compound · Research Use Only

Tesamorelin

Axiom Tested · Lot VerifiedHow to verify a COA

1 · Single Vial

Single Vial

$79.99

Select Strength

New to Lucid? Use code LUCID at checkout for 40% off single vials on your first order.

if an approved accredited lab finds your sealed vial fails HPLC, we refund your order and pay you $500.
Damaged in shipping? Send photos within 24 hours of delivery and we'll replace it. How it works

2 · Bundle & Save

Buy Any 3, Save 20%

Any 3 single vials, mixed however you like. 20% off, applied in your cart.

0/3

Add 3 vials to unlock 20% off.

3 · Bundle & Save

Buy Any 5, Save 30%

Any 5 single vials, mixed however you like. 30% off, applied in your cart.

0/5

Add 5 vials to unlock 30% off.

4 · Best Value

10 mg Kit (10 Vials)

Contains 10 vials.

$399.00

Testing guarantee & shipping

if an approved accredited lab finds your sealed vial fails HPLC, we refund your order and pay you $500.
Damaged in shipping? Send photos within 24 hours of delivery and we'll replace it. How it works

New to Lucid? Use code LUCID at checkout for 40% off single vials on your first order.

if an approved accredited lab finds your sealed vial fails HPLC, we refund your order and pay you $500.
Damaged in shipping? Send photos within 24 hours of delivery and we'll replace it. How it works

Research Use Only. Not for human therapeutic, dietary, or veterinary use.

Compound: Tesamorelin
Strength: 10 mg or 20 mg
Format: Lyophilized powder
Packaging: Sealed vial

Specifications

Molecular formula: C221H366N72O67S
Molecular weight: 5135.8 g/mol
CAS number: 218949-48-5
Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Formula and molecular weight are for the free peptide (no salt or counter-ion). The lot's Axiom certificate of analysis is the reference for each batch. How to verify a COA

No supporting documentation is currently attached to this product. Certificates of analysis and other documents will appear here when they are supplied and verified.

[PLACEHOLDER: upload COA]

Tracked shipping from Ohio. Order by 2 PM Eastern and it ships the same business day. Full details in our Shipping & Returns policy.

For in-vitro laboratory research only. Not a drug, supplement or cosmetic, and not for human or animal use. We don't give dosing, reconstitution or use guidance. Tesamorelin is an investigational research compound and has not been approved by the FDA.

Every vial accounted for.

Sealed, labeled, and traceable to its batch certificate.

Research use only.

Restrictions stated on every product.

Ships from Ohio.

USA-Sourced. Tracked shipping on every order.

21+ only